General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "K7G9L4",
        "id": "K7G9L4_PELSI",
        "source_organism": {
            "taxId": "13735",
            "scientificName": "Pelodiscus sinensis",
            "fullName": "Pelodiscus sinensis (Chinese softshell turtle)"
        },
        "name": "Sulfotransferase",
        "description": [
            "Atypical sulfotransferase family member with very low affinity for 3'-phospho-5'-adenylyl sulfate (PAPS) and very low catalytic activity towards L-triiodothyronine, thyroxine, estrone, p-nitrophenol, 2-naphthylamine, and 2-beta-naphthol. May have a role in the metabolism of drugs and neurotransmitters in the CNS"
        ],
        "length": 286,
        "sequence": "QAQAQAQAPPLPGFWFESKYFEYNGVRLPPFCRGKMEEIANFPVRDSDVWIVTYPKSGGTGLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSLRTMSYRGTFQEFCRRFMNDKLGYGSWFDHVQEFWEHHMDSNVLFLKYEDMHKDLATMVEQLVRFLGVSYDKAQLESMVEHCHQLIDQCCNAEALPVGRGRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTFDFYL",
        "proteome": "UP000007267",
        "gene": "SULT4A1",
        "go_terms": [
            {
                "identifier": "GO:0008146",
                "name": "sulfotransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c3f904adb28054815298b5a4924ad2c008edc08c",
        "counters": {
            "domain_architectures": 55737,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 55737
        }
    }
}