GET /api/protein/UniProt/K7G702/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "K7G702",
        "id": "K7G702_PELSI",
        "source_organism": {
            "taxId": "13735",
            "scientificName": "Pelodiscus sinensis",
            "fullName": "Pelodiscus sinensis (Chinese softshell turtle)"
        },
        "name": "Mediator of RNA polymerase II transcription subunit 31",
        "description": [
            "Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors"
        ],
        "length": 136,
        "sequence": "MRFIYTDLPFPPTSDDTGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKSFVNYLKYLLYWKEPEYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNSTSVK",
        "proteome": "UP000007267",
        "gene": "MED31",
        "go_terms": [
            {
                "identifier": "GO:0003712",
                "name": "transcription coregulator activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006355",
                "name": "regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016592",
                "name": "mediator complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "23e17a8fdf24714f0573d0184fb25e956170c29f",
        "counters": {
            "domain_architectures": 4104,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4104
        }
    }
}