General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "K4FYM7",
        "id": "K4FYM7_CALMI",
        "source_organism": {
            "taxId": "7868",
            "scientificName": "Callorhinchus milii",
            "fullName": "Callorhinchus milii (Ghost shark)"
        },
        "name": "Multifunctional fusion protein",
        "description": [
            "Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Acts as a ligand for FGFR1 and integrins. Binds to FGFR1 in the presence of heparin leading to FGFR1 dimerization and activation via sequential autophosphorylation on tyrosine residues which act as docking sites for interacting proteins, leading to the activation of several signaling cascades. Binds to integrins. Its binding to integrins and subsequent ternary complex formation with integrins and FGFR1 are essential for FGF1 signaling"
        ],
        "length": 152,
        "sequence": "MAVTTLADLSGSLNHLPGCHNDPKLLYCENGGYFIRILPDGTVEGTRDRSDMYIQLQLQAVSVGVVVIEGIRAKRYLAMNEKGQLHSLPSLTNECLFMESLEENSFNTYKSKEYADRNWYVAIRKNGAAKPGQKTGHHQKAILFLPMQVTSD",
        "proteome": "UP000314986",
        "gene": "fgf1",
        "go_terms": [
            {
                "identifier": "GO:0008083",
                "name": "growth factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5171d0377b6deb31d3e4658b327f83b114bedf70",
        "counters": {
            "domain_architectures": 24103,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "smart": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "prints": 2,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 24103
        }
    }
}