GET /api/protein/UniProt/K4FS94/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "K4FS94",
"id": "K4FS94_CALMI",
"source_organism": {
"taxId": "7868",
"scientificName": "Callorhinchus milii",
"fullName": "Callorhinchus milii (Ghost shark)"
},
"name": "Complex III subunit 9",
"description": [
"Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylation. The complex plays an important role in the uptake of multiple carbon sources present in different host niches"
],
"length": 62,
"sequence": "MAFARRVYNSLFRRTSTFALTIIVSAFVFERAFDQGGDALFEHLNRGKLWKHIRHNYVKNDD",
"proteome": "UP000314986",
"gene": "uqcr10",
"go_terms": [
{
"identifier": "GO:0006122",
"name": "mitochondrial electron transport, ubiquinol to cytochrome c",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0045275",
"name": "respiratory chain complex III",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 2,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "8c0c3c8acf47a0be30d1a133b36f40da3019df9b",
"counters": {
"domain_architectures": 3091,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"panther": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3091
}
}
}