HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "K1W8P1",
"id": "K1W8P1_MARBU",
"source_organism": {
"taxId": "1072389",
"scientificName": "Marssonina brunnea f. sp. multigermtubi (strain MB_m1)",
"fullName": "Marssonina brunnea f. sp. multigermtubi (strain MB_m1) (Marssonina leaf spot fungus)"
},
"name": "3-hydroxyacyl-CoA dehydrogenase",
"description": null,
"length": 318,
"sequence": "MISPILRRKLVQGTRHNRCFSSSPMLAAQEVRRLGVIGAGQMGLGIALVAAQKAGVPVTLVDTNQASIDKGLSFADKLLAKDVTKKRITQEESDKARSLLTPSTTMDALSEADFVIEAVPEIPSLKFDIFSKLAQICPPHAILATNTSSISITRIAASTSKDPTDTSASSRVISTHFMNPVPIQKGVEIITGLQTSQSTVDTAIALCEAMGKIPSQSADSPGFLANRILMPYINEAIICLETGVGKRDDIDAIMKNGTNVPMGPLQLADFIGIDTCLAIMKVLYEETGDSKYRPSVLLRKMVDAGWLGKKSGKGFYDY",
"proteome": "UP000006753",
"gene": "MBM_08283",
"go_terms": [
{
"identifier": "GO:0070403",
"name": "NAD+ binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006631",
"name": "fatty acid metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016491",
"name": "oxidoreductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016616",
"name": "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "4284d99bfe08e8b0f62de61d7ec240c3c8811a25",
"counters": {
"domain_architectures": 39081,
"entries": 16,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"pfam": 2,
"panther": 1,
"pirsf": 1,
"prosite": 1,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 39081
}
}
}