GET /api/protein/UniProt/K0DKP5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "K0DKP5",
        "id": "K0DKP5_9BURK",
        "source_organism": {
            "taxId": "1229205",
            "scientificName": "Paraburkholderia phenoliruptrix BR3459a",
            "fullName": "Paraburkholderia phenoliruptrix BR3459a"
        },
        "name": "DNA polymerase III subunit epsilon",
        "description": [
            "DNA polymerase III is a complex, multichain enzyme responsible for most of the replicative synthesis in bacteria. The epsilon subunit contain the editing function and is a proofreading 3'-5' exonuclease"
        ],
        "length": 244,
        "sequence": "MRQLILDTETTGLNARTGDRIIEVGCVELVNRRLTGNNLHFYINPERDSDPGALAVHGLTTEFLSDKPKFAEIADEFRDFIQGADLIIHNAPFDIGFLDAEFALLGLPPVSTHCGEIIDTLARAKQMFPGKRNSLDALCDRFGISNAHRTLHGALLDSELLAEVYLAMTRGQESLVIDMLGESHAGGEAHAPRVALDSLDLVVIAASDEELAAHQAVLDGLDKAIKGTSVWRLEPAPVSDEQAA",
        "proteome": null,
        "gene": "dnaQ",
        "go_terms": [
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003887",
                "name": "DNA-directed DNA polymerase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006260",
                "name": "DNA replication",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5aad122e81bfc5b649ae462596f1030cc5a1692e",
        "counters": {
            "domain_architectures": 85258,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "smart": 1,
                "cdd": 1,
                "pfam": 1,
                "ncbifam": 3,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 85258
        }
    }
}