General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "J9VMQ6",
        "id": "J9VMQ6_CRYN9",
        "source_organism": {
            "taxId": "235443",
            "scientificName": "Cryptococcus neoformans (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487)",
            "fullName": "Cryptococcus neoformans (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487)"
        },
        "name": "Mitochondrial distribution and morphology protein 34",
        "description": [
            "Component of the ERMES/MDM complex, which serves as a molecular tether to connect the endoplasmic reticulum (ER) and mitochondria. Components of this complex are involved in the control of mitochondrial shape and protein biogenesis, and function in nonvesicular lipid trafficking between the ER and mitochondria. MDM34 is required for the interaction of the ER-resident membrane protein MMM1 and the outer mitochondrial membrane-resident beta-barrel protein MDM10"
        ],
        "length": 343,
        "sequence": "MSFVFPSWSTAFSPAFHEDAKAMLEGALNKGDKPPVIQGKIEVVELHMGEQPPTLTLLEIGDLSIDRFRGILRLGYQGDAWLEVRCRVQANPLSHNPHLTSSTLPLSTPLLASQPLLVPMTLRLSKLHLRAILILVVSASKGITLVFKNDPLQNVDVSSTFDSVEVIRGYLQQEIEGQLREMFREHLPSIIHRLSQKWFSGSGVGGKVEMPYRDTSPVPSYAPINEEVEEEENEENHGSSPGNEGSFPPRHIGPGGITLPLNNSVSQLAALSYSAHTLSPYARGHEHIAVRSFPYLGKNGAGTGSSGRASLASSSVGEGDIKAKRKRIFRIGKSKEADEKSEI",
        "proteome": "UP000010091",
        "gene": "MDM34",
        "go_terms": [
            {
                "identifier": "GO:0008289",
                "name": "lipid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0007005",
                "name": "mitochondrion organization",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0032865",
                "name": "ERMES complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "973c70ff860523af7498c3606c7ff3408ff41cbe",
        "counters": {
            "domain_architectures": 800,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "profile": 1,
                "pfam": 1,
                "panther": 1,
                "hamap": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 800
        }
    }
}