HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "J9R8B3",
"id": "J9R8B3_RIEAN",
"source_organism": {
"taxId": "1228997",
"scientificName": "Riemerella anatipestifer RA-CH-1",
"fullName": "Riemerella anatipestifer RA-CH-1"
},
"name": "Transcriptional regulator MntR",
"description": [
"In the presence of manganese, represses expression of mntH and mntS. Up-regulates expression of mntP"
],
"length": 217,
"sequence": "MNSLTEENYLKALFHLKTDNNEVTVNELSKFLNIKMPSVNSMMKKFAQKNWVITESYKPIILTEIGQKEAALVIRKHRLTEMFLVEKMGFGWENVHKIAEELEHIHSEEFFDKMDELLNYPKVDPHGEPIPDKEGNIIEQNLKKLSECTEGSKVTLAAVTVDTKDFLSFLNDKQLNLGSQLTVNKKEKFDASMMVTVNGISHTFSKVVCDALLVKLD",
"proteome": "UP000006276",
"gene": "B739_2096",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003700",
"name": "DNA-binding transcription factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0046914",
"name": "transition metal ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0046983",
"name": "protein dimerization activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e0f378aca321f7f0cb76b52b50098711568c19b4",
"counters": {
"domain_architectures": 8699,
"entries": 20,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"cathgene3d": 3,
"pfam": 3,
"ssf": 2,
"smart": 1,
"panther": 1,
"interpro": 9
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 8699
}
}
}