GET /api/protein/UniProt/J7TR53/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "J7TR53",
"id": "J7TR53_MORMO",
"source_organism": {
"taxId": "1124991",
"scientificName": "Morganella morganii subsp. morganii KT",
"fullName": "Morganella morganii subsp. morganii KT"
},
"name": "Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase",
"description": [
"Catalyzes the synthesis of alpha-ribazole-5'-phosphate from nicotinate mononucleotide (NAMN) and 5,6-dimethylbenzimidazole (DMB)"
],
"length": 353,
"sequence": "MTTLKDLIRAIPPLDHTAMQAAEQHINGLAKPPRSLGRLEDLAVHLAGMPGINHPDNLPKEIIVMCADHGVFAEGVAVTPQEVTAIQARNIQKQLTGVCAVARSNGTSVLPVDIGIDCDPIDDMISLKLARGCGNIAKGPAMSYADAEHLLIASAELVKQRVAAGIRVVGTGELGIANTTPASAMISVLCGLDPHDTVGIGANLPLDRVSHKEAIVRQAIALNKPDPADAIDVLAKVGGYDLTGMTGVILGAAACGIPVVLDGFLSYACAIAACRLAPAVRDYLIPSHFSAEKGAGIALEQLGLKPFLYLDLRLGEGSGAALAMSVINAACSMYCHMGHQAGSGFTLPPSPTR",
"proteome": "UP000011834",
"gene": "cobT",
"go_terms": [
{
"identifier": "GO:0008939",
"name": "nicotinate-nucleotide-dimethylbenzimidazole phosphoribosyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009236",
"name": "cobalamin biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "75e5de0462f5cc0744e9c53320ccc7f2efc85e95",
"counters": {
"domain_architectures": 15132,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 2,
"pfam": 1,
"cdd": 1,
"ncbifam": 2,
"panther": 1,
"hamap": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 15132
}
}
}