HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "J7K7J6",
"id": "J7K7J6_BPV1",
"source_organism": {
"taxId": "2758380",
"scientificName": "Bos grunniens papillomavirus 1",
"fullName": "Bos grunniens papillomavirus 1"
},
"name": "Regulatory protein E2",
"description": [
"Plays a role in the initiation of viral DNA replication. A dimer of E2 interacts with a dimer of E1 in order to improve specificity of E1 DNA binding activity. Once the complex recognizes and binds DNA at specific sites, the E2 dimer is removed from DNA. E2 also regulates viral transcription through binding to the E2RE response element (5'-ACCNNNNNNGGT-3') present in multiple copies in the regulatory regions of the viral genome. Activates or represses transcription depending on E2RE's position with regards to proximal promoter elements including the TATA-box. Repression occurs by sterically hindering the assembly of the transcription initiation complex"
],
"length": 412,
"sequence": "METACERLHVAQETQMQLIEKSSNNLQDHILYWTAVRNENTLLYAARKKGVTVLGHCRVPHSVVCQERAKQAIEMQLSLQELRKTEFGDEPWSLLDTSWDRYIAEPKRCFKKGARVVEVEFDGNASNTNWYTVYSNLYMRTDDGWLLAKAGADGTGLYYCTMAGGGRIYYSRFGDEAARFSTTGHYSVRDQDRVYAGVSSTSSDFRDRPDGVWVASEGPEGDPPGKEAEPAQPVSPLLGSPACGPVRAGLGWVRDHSRSHPYHFPTGSGGCLFRPTSTPVQSQVPLDLAPRQEEDEEQSPDSTEEEAITLPRRNAHDDGFHLLKAGGSCFALISGSANQVKCYRFRVKKNHRHRYENCTTTWFTVADNGAERQGQAQILITFGSSSQRQDFLKHVPLPPGMNISGFTASLDF",
"proteome": null,
"gene": "E2",
"go_terms": [
{
"identifier": "GO:0006275",
"name": "regulation of DNA replication",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016032",
"name": "viral process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003700",
"name": "DNA-binding transcription factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0042025",
"name": "host cell nucleus",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "aa847dfaf95aadb5b075b19e49187d0e6b959e63",
"counters": {
"domain_architectures": 2567,
"entries": 16,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 3,
"pfam": 2,
"ssf": 2,
"hamap": 1,
"interpro": 8
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 2567
}
}
}