HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "J7FAL9",
"id": "J7FAL9_VACCV",
"source_organism": {
"taxId": "32605",
"scientificName": "Buffalopox virus",
"fullName": "Buffalopox virus"
},
"name": "Protein OPG190",
"description": [
"Plays a role in the dissolution of the outermost membrane of extracellular enveloped virions (EV) to allow virion entry into host cells. Also participates in wrapping mature virions (MV) to form enveloped virions (EV)"
],
"length": 317,
"sequence": "MKTISVVTLLCVLPAVVYSTCTVPTMNNAKLTSTETSFNNNQKVTFTCDQGYHSSDPNAVCETNKWKYENPCKKMCTVSDYISELYNKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYITINCDVGYEVIGASYISCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFILTGSPSSTCIDGKWNPILPTCVRFNEKFDPVDGGPDDETDLSKLSKDVVQYEQEIESLEATYHIIIVALTIMGVIFLISVIVLVCSCDKNNDQYKFHKLLP",
"proteome": null,
"gene": "B5R",
"go_terms": [
{
"identifier": "GO:0001848",
"name": "complement binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0045916",
"name": "negative regulation of complement activation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "f2dcf5f3eb34cd32e3dfd4a058f01bed7ffa2b22",
"counters": {
"domain_architectures": 3062,
"entries": 12,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"pfam": 1,
"smart": 1,
"ssf": 1,
"cdd": 1,
"pirsf": 1,
"panther": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 3062
}
}
}