GET /api/protein/UniProt/J5TAM1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "J5TAM1",
        "id": "J5TAM1_TRIAS",
        "source_organism": {
            "taxId": "1186058",
            "scientificName": "Trichosporon asahii var. asahii (strain ATCC 90039 / CBS 2479 / JCM 2466 / KCTC 7840 / NBRC 103889/ NCYC 2677 / UAMH 7654)",
            "fullName": "Trichosporon asahii var. asahii (strain ATCC 90039 / CBS 2479 / JCM 2466 / KCTC 7840 / NBRC 103889/ NCYC 2677 / UAMH 7654) (Yeast)"
        },
        "name": "Inosine triphosphate pyrophosphatase",
        "description": [
            "Pyrophosphatase that hydrolyzes non-canonical purine nucleotides such as inosine triphosphate (ITP), deoxyinosine triphosphate (dITP) or xanthosine 5'-triphosphate (XTP) to their respective monophosphate derivatives. The enzyme does not distinguish between the deoxy- and ribose forms. Probably excludes non-canonical purines from RNA and DNA precursor pools, thus preventing their incorporation into RNA and DNA and avoiding chromosomal lesions"
        ],
        "length": 213,
        "sequence": "MPKSFVFVTGNANKLREVREILQTGGSGIECTNAAVDVPELQGTTQEVAKAKCAAAAKALNAPCVTEDTALCFEALGGLPGPYIKDFLGTVGHDASPSEGRFTRRHSLSFDKYAGQANNAGLNKMLVGFNNTNAHALCTFAYCAGPGEEPILFEGRTDGDIVPARGPSNFGWDPVFQPKEGGGKTYAEMESAEKNKISHRYRALEKLKDYLSQ",
        "proteome": null,
        "gene": "A1Q1_00822",
        "go_terms": [
            {
                "identifier": "GO:0047429",
                "name": "nucleoside triphosphate diphosphatase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009143",
                "name": "nucleoside triphosphate catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "029a777975285995c6aff1e90978714c8929fb21",
        "counters": {
            "domain_architectures": 32111,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "hamap": 1,
                "ncbifam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 32111
        }
    }
}