GET /api/protein/UniProt/J5J801/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "J5J801",
"id": "J5J801_BEAB2",
"source_organism": {
"taxId": "655819",
"scientificName": "Beauveria bassiana (strain ARSEF 2860)",
"fullName": "Beauveria bassiana (strain ARSEF 2860) (White muscardine disease fungus)"
},
"name": "Dehydrogenase FUB6",
"description": null,
"length": 349,
"sequence": "MAPNKTLIFKKVPKGLPVPGQDLVVEDREIDLETPPKGGLVLEVLEASYDPYLRGRMRESNTKSYSPPFELNGPVSNATLSRVLKSDNPDYQEGDIVRASTPIAEYARLDDPAKFQAYKIKNPHNVDLSYFLGPLGMSGLTAWSSLYNIGKPKKGETIFVSSAAGSVGQIVGQIAKHEGLTVIGSVGSDDKVDFITKELGFDAGFNYKKEKPADALPRLAPEGIDIYYENVGGEHLAAALDNMKNGGRIPVCGMISGYNQEASERASINNLFQLIAKQILMQGFLVFAPGFGPAYFQEHMDKLSSWLADGTFKSKLHFTEGIDKAAEGFVDMLEGRNFGKAILRIKSQK",
"proteome": "UP000002762",
"gene": "BBA_08439",
"go_terms": [
{
"identifier": "GO:0016491",
"name": "oxidoreductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016628",
"name": "oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5868aa2108b93d49c5c92d05158401122f1a86a6",
"counters": {
"domain_architectures": 28175,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"cdd": 1,
"cathgene3d": 2,
"smart": 1,
"pfam": 2,
"panther": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 28175
}
}
}