GET /api/protein/UniProt/J4KN94/?format=api
HTTP 200 OK
Allow: GET, HEAD
Cached: true
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Server-Timing:
Vary: Accept
{
"metadata": {
"accession": "J4KN94",
"id": "J4KN94_BEAB2",
"source_organism": {
"taxId": "655819",
"scientificName": "Beauveria bassiana (strain ARSEF 2860)",
"fullName": "Beauveria bassiana (strain ARSEF 2860) (White muscardine disease fungus)"
},
"name": "Small ribosomal subunit protein uS7m",
"description": [
"Component of the mitochondrial ribosome (mitoribosome), a dedicated translation machinery responsible for the synthesis of mitochondrial genome-encoded proteins, including at least some of the essential transmembrane subunits of the mitochondrial respiratory chain. The mitoribosomes are attached to the mitochondrial inner membrane and translation products are cotranslationally integrated into the membrane"
],
"length": 341,
"sequence": "MAAAMPRGMRILHECRGLAIRTRHACRRPQLPPQLLHAYRFQSNDANNRTPRATGSDAASESSVTAEASPYNPLDRIDDAALEQMLYGGRATKQGGLTQAQEEVLYRDGAIPPAEEAEAVLAVEGAEEAELEEAGESGKGGEDIQKLGHKWPLPQKPYPDDFNVKKRYHPVVQQIVRLMMRDGKLATAQRNLAMTMNFLRMAPEPTFSPKFPLLPGTPPASHLSLNPILYLTVAIDSVAPLIRVKPIAGAAGGGRALDMPQPLTVRQRRRRAFTWILEAVEKKPSKGSGRAQFAHRLAEEIIAVVEGRSSVWDKRKLVHKQGTTARANVDKKLTIKKGPSK",
"proteome": "UP000002762",
"gene": "BBA_05640",
"go_terms": [
{
"identifier": "GO:0006412",
"name": "translation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b38a96b66a03eafcff49a4d98ca22b5cde0cd722",
"counters": {
"domain_architectures": 57558,
"entries": 7,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 57558
}
}
}