General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "J3JZ67",
        "id": "J3JZ67_DENPD",
        "source_organism": {
            "taxId": "77166",
            "scientificName": "Dendroctonus ponderosae",
            "fullName": "Dendroctonus ponderosae (Mountain pine beetle)"
        },
        "name": "Defective in cullin neddylation protein",
        "description": [
            "Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity"
        ],
        "length": 230,
        "sequence": "MSSADDDRYVSKRLRHTSGRRARVEDTSFSPKRCLAWFREYTTPVEPDTLGPEGMEKFCKCIGVEPENVVMLVLAYKMQARRMGFFTKDEWLKGLSDLQCDTIQKLQFKLDFMCSLLNDQNVFKAVFRYAYDFARDKDQRSMDMETAKAMLQLLLAKQWSLFKQFDEFLDQSKYKVINKDQWCNILEFSRTIFNDLSNYDVDGAWPVMLDEFVEWLKLARSKSDVMTPLH",
        "proteome": null,
        "gene": null,
        "go_terms": null,
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "aa9b7783716604b54160d7347c630aebb2e0f5d9",
        "counters": {
            "domain_architectures": 8047,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "profile": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 8047
        }
    }
}