GET /api/protein/UniProt/J3JUK5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "J3JUK5",
        "id": "J3JUK5_DENPD",
        "source_organism": {
            "taxId": "77166",
            "scientificName": "Dendroctonus ponderosae",
            "fullName": "Dendroctonus ponderosae (Mountain pine beetle)"
        },
        "name": "Eukaryotic translation initiation factor 3 subunit E",
        "description": [
            "Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation"
        ],
        "length": 440,
        "sequence": "MAKFDLTSKIGQYLDRHLVFPLLEFLSAKENYDETEVLKAKLDILSKTNMIDYAIDIRKQLYPRDEVPEDLKQRRQHVVAQLQELQQVVEPILQIMANEDIMKNMENLRDSKTLIAYLEKEVRFDMDMINSLHALAKYRYECGNYSVSTSYLYFCMLVLPPSDKNYLSALWGKFASEILVQNWDSALEDLNKLREHIDNSPHQYGGSMLNLLQQRTWLIHWSLFVFFNHAMGRELIIEMFLYRPHYLNAIQTMCPHILRYLATAVIINRGRRSALKDLVKVIQQESYTYRDPITEFLEHLYVNFDFDGARQKLRECETVLFNDFFLISCLDEFVENARLMIFETFCRIHQCISIGMLAEKLNMNPDEAECWIVNLIRNARLDAKIDSKLGHVVMGAQPMSPYQQLIEKIDSLSVRSETLSALIDRKLKAKTDLRWGPQEF",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0003743",
                "name": "translation initiation factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0005852",
                "name": "eukaryotic translation initiation factor 3 complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c4806a904b5eadf37b5ba070f4c9239c098f487d",
        "counters": {
            "domain_architectures": 1276,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "pfam": 2,
                "smart": 2,
                "profile": 1,
                "ssf": 1,
                "panther": 1,
                "pirsf": 1,
                "hamap": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 1276
        }
    }
}