General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "J3JTF2",
        "id": "J3JTF2_DENPD",
        "source_organism": {
            "taxId": "77166",
            "scientificName": "Dendroctonus ponderosae",
            "fullName": "Dendroctonus ponderosae (Mountain pine beetle)"
        },
        "name": "Sorting nexin-3",
        "description": [
            "Required for retention of late Golgi membrane proteins. Component of the retrieval machinery that functions by direct interaction with the cytosolic tails of certain TGN membrane proteins during the sorting/budding process at the prevacuolar compartment. Binds phosphatidylinositol 3-phosphate (PtdIns(P3))"
        ],
        "length": 169,
        "sequence": "MMAESDTTSEAIKRLNVKKQTLDDAYAAPANFLEIDVVNPVTTIGVGKKRFTDYEVKMKTNLPVFKVKESSVRRRYSDFEWLRNELERDSKIVVPSLPGKAWKRQLPFRGDDGIFEEGFIEDRRKGLEVFINKIAGHPLAQNERCLHMFLQEPAIDKNYVPGKIRNTNF",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0035091",
                "name": "phosphatidylinositol binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ad261f154f38ce159e1eb6f55507e37aff327fbd",
        "counters": {
            "domain_architectures": 35144,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "cdd": 1,
                "profile": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 35144
        }
    }
}