GET /api/protein/UniProt/J0QE17/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "J0QE17",
"id": "J0QE17_HELPX",
"source_organism": {
"taxId": "992080",
"scientificName": "Helicobacter pylori Hp P-15",
"fullName": "Helicobacter pylori Hp P-15"
},
"name": "Glycerol-3-phosphate acyltransferase",
"description": [
"Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as fatty acyl donor, but not acyl-CoA or acyl-ACP"
],
"length": 220,
"sequence": "MESVLNFLTNINVIFTLLGYLIGGIPFGYALMKIFYGMDITKIGSGGIGATNVLRALQSKGVSNAKQMALLVLILDLFKGMFAVFLSKLFGLDYSLQWMVAIASILGHCYSPFLNFNGGKGVSTIMGSVVLLIPIESLIGLTVWFFVGKVLKISSLASILGVGTATVLIFFVPYMHIPDSVNILKEVGTQTPMVLIFIFTLIKHAGNIFNLLAGKEKKVL",
"proteome": null,
"gene": "plsY",
"go_terms": [
{
"identifier": "GO:0043772",
"name": "acyl-phosphate glycerol-3-phosphate acyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008654",
"name": "phospholipid biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005886",
"name": "plasma membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "7dfe14e5027783d2cdf9d0df7217f72b1f646d6d",
"counters": {
"domain_architectures": 19421,
"entries": 6,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 1,
"ncbifam": 1,
"panther": 1,
"hamap": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 19421
}
}
}