GET /api/protein/UniProt/I9S2S8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "I9S2S8",
        "id": "I9S2S8_9BACE",
        "source_organism": {
            "taxId": "997884",
            "scientificName": "Bacteroides nordii CL02T12C05",
            "fullName": "Bacteroides nordii CL02T12C05"
        },
        "name": "Serine hydroxymethyltransferase",
        "description": [
            "Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism"
        ],
        "length": 426,
        "sequence": "MKRDDLIFDIIEKEHQRQLKGIELIASENFVSDQVMEAMGSCLTNKYAEGYPGKRYYGGCEVVDQSEQIAIDRLKEIFGAEWANVQPHSGAQANAAVFLAVLNPGDKFMGLNLAHGGHLSHGSLVNTSGLIYTPCEYNLNKETGRVDYDQMEEVALREHPKMIIGGGSAYSREWDYKRMREIADKVGAILMIDMAHPAGLIAAGLLDNPLKYAHIVTSTTHKTLRGPRGGVIMMGKDFPNPWGKTTPKGEIKMMSQLLDSAVFPGIQGGPLEHVIAAKAVAFGECLQPEYIEYQKQVQKNASVLAQALIDRGFTIVSGGTDNHSMLVDLRSKYPDLTGKVAEKALVAADITVNKNMVPFDSRSAFQTSGIRLGTPAITTRGAKEDLMLEIAEMIETVLSNVDNEEVIAQIRARVNKTMEKYPIFAY",
        "proteome": "UP000003089",
        "gene": "glyA",
        "go_terms": [
            {
                "identifier": "GO:0004372",
                "name": "glycine hydroxymethyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0030170",
                "name": "pyridoxal phosphate binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019264",
                "name": "glycine biosynthetic process from L-serine",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0035999",
                "name": "tetrahydrofolate interconversion",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a467f6dfa8ae11c9935b71e94ed54da4f6601504",
        "counters": {
            "domain_architectures": 46777,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "ssf": 1,
                "pfam": 1,
                "cathgene3d": 2,
                "hamap": 1,
                "panther": 1,
                "pirsf": 1,
                "ncbifam": 1,
                "prosite": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 46777
        }
    }
}