HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "I9S2S8",
"id": "I9S2S8_9BACE",
"source_organism": {
"taxId": "997884",
"scientificName": "Bacteroides nordii CL02T12C05",
"fullName": "Bacteroides nordii CL02T12C05"
},
"name": "Serine hydroxymethyltransferase",
"description": [
"Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism"
],
"length": 426,
"sequence": "MKRDDLIFDIIEKEHQRQLKGIELIASENFVSDQVMEAMGSCLTNKYAEGYPGKRYYGGCEVVDQSEQIAIDRLKEIFGAEWANVQPHSGAQANAAVFLAVLNPGDKFMGLNLAHGGHLSHGSLVNTSGLIYTPCEYNLNKETGRVDYDQMEEVALREHPKMIIGGGSAYSREWDYKRMREIADKVGAILMIDMAHPAGLIAAGLLDNPLKYAHIVTSTTHKTLRGPRGGVIMMGKDFPNPWGKTTPKGEIKMMSQLLDSAVFPGIQGGPLEHVIAAKAVAFGECLQPEYIEYQKQVQKNASVLAQALIDRGFTIVSGGTDNHSMLVDLRSKYPDLTGKVAEKALVAADITVNKNMVPFDSRSAFQTSGIRLGTPAITTRGAKEDLMLEIAEMIETVLSNVDNEEVIAQIRARVNKTMEKYPIFAY",
"proteome": "UP000003089",
"gene": "glyA",
"go_terms": [
{
"identifier": "GO:0004372",
"name": "glycine hydroxymethyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0030170",
"name": "pyridoxal phosphate binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0019264",
"name": "glycine biosynthetic process from L-serine",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0035999",
"name": "tetrahydrofolate interconversion",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a467f6dfa8ae11c9935b71e94ed54da4f6601504",
"counters": {
"domain_architectures": 46777,
"entries": 17,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"ssf": 1,
"pfam": 1,
"cathgene3d": 2,
"hamap": 1,
"panther": 1,
"pirsf": 1,
"ncbifam": 1,
"prosite": 1,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 46777
}
}
}