General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "I9Q5Y2",
        "id": "I9Q5Y2_9BACE",
        "source_organism": {
            "taxId": "997874",
            "scientificName": "Bacteroides cellulosilyticus CL02T12C19",
            "fullName": "Bacteroides cellulosilyticus CL02T12C19"
        },
        "name": "ATP-dependent DNA helicase RecG",
        "description": [
            "Plays a critical role in recombination and DNA repair. Helps process Holliday junction intermediates to mature products by catalyzing branch migration. Has replication fork regression activity, unwinds stalled or blocked replication forks to make a HJ that can be resolved. Has a DNA unwinding activity characteristic of a DNA helicase with 3'-5' polarity"
        ],
        "length": 698,
        "sequence": "MFDLASRDIKYLSGVGPQRASVLNKELNIYSLHDLLYYFPYKYVDRSRIYYIHEIDGTMPYIQLKGEILGFETIGEGRQRRLIAHFSDGTGIVDLVWFQGIKFLVGKYKVHQEYIVFGKPSVFNGRINIAHPDIDNASELKLSTMGLQPYYNTTEKMKRSSLNSHAIEKMMSAVVQQLREPLPETLSPAILTEHHLMPLTEALMNIHFPANPELLRKAQYRLKFEELFYVQLNILRYAKDRQRKYRGYVFETVGEIFNTFYAKNLPFELTGAQKRVLKEIRRDVGSGKQMNRLLQGDVGSGKTLVALMSMLIALDNGYQACMMAPTEILANQHFETIRELLYGMDIRVELLTGSVKGKKREAILTGLLTGDVRILIGTHAVIEDTVNFSSLGLVVIDEQHRFGVAQRARLWTKNAQPPHVLVMTATPIPRTLAMTLYGDLDVSVIDELPPGRKPIVTIHKYDAHRVSLYQSVHRQIAEGRQVYIVYPLIKESEKIDLKNLEEGYLHICEEFPDCKVCKVHGKMKAAEKDAQMQLFVSGEAQIMVATTVIEVGVNVPNASVMIIENAERFGLSQLHQLRGRVGRGAEQSYCILVTGYKLVEETRKRLEIMVRTNDGFEIAEADLKLRGPGDLEGTQQSGIAFDLKIADIARDGQLLQYVRNVAEEVVDADPTGIRPENEILWRQLKALRKTNVNWASIS",
        "proteome": "UP000003741",
        "gene": "HMPREF1062_04810",
        "go_terms": [
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006281",
                "name": "DNA repair",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003678",
                "name": "DNA helicase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006310",
                "name": "DNA recombination",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "897d7690ef80b94bfd80c7b7f81a4526019fa4a5",
        "counters": {
            "domain_architectures": 21191,
            "entries": 27,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "pfam": 4,
                "cathgene3d": 2,
                "cdd": 2,
                "smart": 2,
                "profile": 2,
                "panther": 1,
                "ncbifam": 3,
                "interpro": 9
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 21191
        }
    }
}