GET /api/protein/UniProt/I7JRD1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "I7JRD1",
        "id": "I7JRD1_9BURK",
        "source_organism": {
            "taxId": "1091495",
            "scientificName": "Taylorella asinigenitalis 14/45",
            "fullName": "Taylorella asinigenitalis 14/45"
        },
        "name": "Septum site-determining protein MinD",
        "description": [
            "ATPase required for the correct placement of the division site. Cell division inhibitors MinC and MinD act in concert to form an inhibitor capable of blocking formation of the polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings"
        ],
        "length": 270,
        "sequence": "MTRVIVVTSGKGGVGKTTTSASFSTGLALRGHKTAVIDFDVGLRNLDLIMGCERRVVYDFINVIQGDATLSQALIKDKKVENLYVLAASQTRDKDALTKEGVEKVINELKEQGFEYIVCDSPAGIETGANLAMYFADDALVVSNPEISSLRDSDRMIGILQSKSLRAENGLEPINTYLVVTRYNPERVTQGDMFSLNDIKEFLNIPIKGVIPESKDILDASNTGVPVILSENSDSGQAYSDLVDRYLGKELPFRFTDYQKPGFFKKLFGG",
        "proteome": null,
        "gene": "minD",
        "go_terms": [
            {
                "identifier": "GO:0016887",
                "name": "ATP hydrolysis activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a20593a32eeedde981f82d3a908f8552fa435245",
        "counters": {
            "domain_architectures": 39982,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "pirsf": 1,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 39982
        }
    }
}