General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "I7IYD5",
        "id": "I7IYD5_9BURK",
        "source_organism": {
            "taxId": "1091497",
            "scientificName": "Taylorella equigenitalis 14/56",
            "fullName": "Taylorella equigenitalis 14/56"
        },
        "name": "Bifunctional chorismate mutase/prephenate dehydratase",
        "description": [
            "Catalyzes the Claisen rearrangement of chorismate to prephenate and the decarboxylation/dehydration of prephenate to phenylpyruvate"
        ],
        "length": 364,
        "sequence": "MADQNELLSKLAPLRDQIDEIDDAILNLLDKRARLAVEVGEIKKKYGSDSDVLKPERETIIFKSLSQKAEVFPSEAVQNVWTEIISACRGLERKLKVAYLGPSGSFSEIAAYKIYGHYIDTISCVTFEEVFKSVESKVADVGVVPVENSTEGTVNTTQDLFLGSKLKIHSECDVEVHHCLLHKTGDISNAKKLFVHPQTRGQCHKWISNNLPNIEIVTARSNSEAAHMASTDSASLAIASESAAIIYDLKCIHHGVQDSSNNKTRFVGIGYINPKPSGNDKTSLIFAASNEAGSVYKLLNPFAEFGVSMSRLESRPFKNGEWEYYFYVDLLGHAEDQNVKKALNVLKSEAPFVKVLGSYPATRS",
        "proteome": null,
        "gene": "pheA",
        "go_terms": [
            {
                "identifier": "GO:0046417",
                "name": "chorismate metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0004106",
                "name": "chorismate mutase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004664",
                "name": "prephenate dehydratase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009094",
                "name": "L-phenylalanine biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "cc138aacc5f38c4b68903643616c89d0c1996657",
        "counters": {
            "domain_architectures": 5019,
            "entries": 28,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "profile": 3,
                "ssf": 3,
                "pfam": 3,
                "smart": 1,
                "cdd": 2,
                "pirsf": 1,
                "panther": 1,
                "ncbifam": 1,
                "prosite": 2,
                "interpro": 8
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 5019
        }
    }
}