HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "I7IVU1",
"id": "I7IVU1_9LACO",
"source_organism": {
"taxId": "1423758",
"scientificName": "Lactobacillus hominis DSM 23910 = CRBIP 24.179",
"fullName": "Lactobacillus hominis DSM 23910 = CRBIP 24.179"
},
"name": "S-adenosylmethionine synthase",
"description": [
"Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme"
],
"length": 402,
"sequence": "MEKEKKLFTSESVSEGHPDKVADQISDAILDAILEKDPYGRVACETTVTTGLVLVVGEISTSAYVDIQSVVRKTILEIGYNKPELGFDGNNCAILVDIDEQSSDIAGGVDESLEVRENNNDTDDLDKIGAGDQGLMFGFAINETPELMPLPISLAHKLMRRVAKLRKDGTLQWLRPDAKAQVTVEYDDNDKPKRVDTVVISTQTDDKVENDEIYNAMVDMVIKQVIPEKYLDDKTKILINPSGRFVIGGPKGDSGLTGRKIIVDTYGGFARHGGGAFSGKDLTKVDRSASYAARYVAKNIVAAGLADRCEIQLAYAIGVAHPVSIMVDTAGTGKVSDDLLVEAIRNIFDLRPAGIIKMLDLRRPIYRQTAAYGHFGRTDVDLPWEHTDKVADLKDYVSKHAN",
"proteome": "UP000009320",
"gene": "metK",
"go_terms": [
{
"identifier": "GO:0004478",
"name": "methionine adenosyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006556",
"name": "S-adenosylmethionine biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "19eaff5c12f42b31629adc7742ec6ffb3fe068a7",
"counters": {
"domain_architectures": 35253,
"entries": 18,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"pfam": 3,
"cathgene3d": 1,
"cdd": 1,
"pirsf": 1,
"panther": 1,
"hamap": 1,
"ncbifam": 1,
"prosite": 2,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 35253
}
}
}