GET /api/protein/UniProt/I7CDE6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "I7CDE6",
"id": "I7CDE6_BRANA",
"source_organism": {
"taxId": "3708",
"scientificName": "Brassica napus",
"fullName": "Brassica napus (Rape)"
},
"name": "Cytokinin riboside 5'-monophosphate phosphoribohydrolase",
"description": [
"Cytokinin-activating enzyme working in the direct activation pathway. Phosphoribohydrolase that converts inactive cytokinin nucleotides to the biologically active free-base forms"
],
"length": 216,
"sequence": "MEENQRSRFKKVCVFCGSHSGNREVFSDAAIELGNELVKRKIDLVYGGGSVGLMGLISRRVYEGGFHVLGIIPKALMPIEISGETVGEVRVVADMHERKAAMAQESEAFIALPGGYGTMEELLEMITWSQLGIHKKTVGILNTDGYYNNLLALFDTGVQEGFIKPGARNIVVSAPTAKELMEKMEEYTPSHKHVASHESWNVEELGAYPGQQSNHQ",
"proteome": null,
"gene": "DARMORV10_A10P25810.1",
"go_terms": [
{
"identifier": "GO:0016787",
"name": "hydrolase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009691",
"name": "cytokinin biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5d061c42754aa23f63d8b54e2ea3f7e545c756c0",
"counters": {
"domain_architectures": 38425,
"entries": 7,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"panther": 1,
"ncbifam": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 38425
}
}
}