GET /api/protein/UniProt/I7BEW8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Cached: true
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Server-Timing:
Vary: Accept
{
"metadata": {
"accession": "I7BEW8",
"id": "I7BEW8_PSEPT",
"source_organism": {
"taxId": "1196325",
"scientificName": "Pseudomonas putida (strain DOT-T1E)",
"fullName": "Pseudomonas putida (strain DOT-T1E)"
},
"name": "Cell division protein ZapA",
"description": [
"Activator of cell division through the inhibition of FtsZ GTPase activity, therefore promoting FtsZ assembly into bundles of protofilaments necessary for the formation of the division Z ring. It is recruited early at mid-cell but it is not essential for cell division"
],
"length": 106,
"sequence": "MSSSNSVTVQILDKEYSIICPPEERNNLVSAARYLDGKMREIRSSGKVIGADRIAVMAALNITHEMLHRQEDRNDAPVSGTNREQVRDLLDRVDKALSDDTDTKIG",
"proteome": null,
"gene": "T1E_4424",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c53cc3f60b50f86d6eaf925d526da9863fb8c89f",
"counters": {
"domain_architectures": 16076,
"entries": 8,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 1,
"panther": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 16076
}
}
}