GET /api/protein/UniProt/I6VFB1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "I6VFB1",
"id": "I6VFB1_9PLEO",
"source_organism": {
"taxId": "490063",
"scientificName": "Alternaria preussii",
"fullName": "Alternaria preussii"
},
"name": "Actin",
"description": [
"Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells"
],
"length": 269,
"sequence": "FPSIVGRPRHHGIMIGMGQKDSYVGDEAQSKRGILTLRYPIEHGVVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPINPKSNREKMTQIVFETFNAPAFYVSIQAVLSLYASGRTTGIVLDSGDGVTHVVPIYEGFALPHAISRVDMAGRDLTDYLMKILAERGYTFSTTAEREIVRDIKEKLCYVALDFEQEIQTASQSSSLEKSYELPDGQVITIGNERFRAPEALFQPSVLGLESGGIHVTTFNSIMKCDVDVRKDLYGNIVM",
"proteome": null,
"gene": null,
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "7c3fd5f9f93389082cb00e4f32e34df39e168dec",
"counters": {
"domain_architectures": 86462,
"entries": 13,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 2,
"smart": 1,
"pfam": 1,
"panther": 1,
"prints": 1,
"prosite": 2,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 86462
}
}
}