GET /api/protein/UniProt/I6TLG2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "I6TLG2",
"id": "I6TLG2_DRODI",
"source_organism": {
"taxId": "7219",
"scientificName": "Drosophila differens",
"fullName": "Drosophila differens (Fruit fly)"
},
"name": "Vacuolar protein sorting-associated protein 51 homolog",
"description": [
"Acts as component of the GARP complex that is involved in retrograde transport from early and late endosomes to the trans-Golgi network (TGN)"
],
"length": 158,
"sequence": "SATDTIRKMKDDFKQMETDVNLLMTKMQSITTFSEQITGTLQGTRSQLCRLSEKHSLLKRLQFLSTLPAKLKSLIEEQNYAQAVQDYLHAQKVFAQYGRQPSFDGIQRDCDAIMADLKERLRQDFQRAGNTAQSLTEIGELLLQLDEKTSDLASEMLR",
"proteome": null,
"gene": null,
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "2d9b8e6f00e48ed4a1a0c85959e444d37d673701",
"counters": {
"domain_architectures": 3812,
"entries": 4,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"panther": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 3812
}
}
}