GET /api/protein/UniProt/I6NE78/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "I6NE78",
        "id": "I6NE78_ERECY",
        "source_organism": {
            "taxId": "931890",
            "scientificName": "Eremothecium cymbalariae (strain CBS 270.75 / DBVPG 7215 / KCTC 17166 / NRRL Y-17582)",
            "fullName": "Eremothecium cymbalariae (strain CBS 270.75 / DBVPG 7215 / KCTC 17166 / NRRL Y-17582) (Yeast)"
        },
        "name": "Non-structural maintenance of chromosomes element 4",
        "description": [
            "Component of the SMC5-SMC6 complex, that promotes sister chromatid alignment after DNA damage and facilitates double-stranded DNA breaks (DSBs) repair via homologous recombination between sister chromatids"
        ],
        "length": 382,
        "sequence": "MTDELPTVKKRRIATDSVGEEVVEGAFGKEFQILQGYRDFENEVIQDRAAVSRTGDISVAMQRLKEVNLLFRKAGDLDLNINSLYAQDSHAVMNVSELASISVRNLKLTDAGKVLKVDDIINSAKRYMLVDFFSELRGEAQSVPTDNDNEEQEQDEENAGDEGDEGVNAGVDSTSNHQFKQNKLRSAFLKQFEVYDDFNQFNWFRMGALFQHLSKSPTVVDHMLGPLAVQKKQRVASQRRPAENIGEKITADTVTKETLSVNQEETTPEQVKKCFKVLLEKNGYNQISLFKFIIDPNSYSRSIEHLFYTSFLIKEGRLVLEDDENGYPAIRPKEPLPTDPKEREIERQRRSDASQKHLIFQMDMPTWKVLIKKFKITDSFLA",
        "proteome": "UP000006790",
        "gene": "Ecym_5634",
        "go_terms": [
            {
                "identifier": "GO:0006281",
                "name": "DNA repair",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005634",
                "name": "nucleus",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0030915",
                "name": "Smc5-Smc6 complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1fd77b4221e74ab0cc1708518c228bf021da2dd4",
        "counters": {
            "domain_architectures": 2524,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2524
        }
    }
}