GET /api/protein/UniProt/I6NE78/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "I6NE78",
"id": "I6NE78_ERECY",
"source_organism": {
"taxId": "931890",
"scientificName": "Eremothecium cymbalariae (strain CBS 270.75 / DBVPG 7215 / KCTC 17166 / NRRL Y-17582)",
"fullName": "Eremothecium cymbalariae (strain CBS 270.75 / DBVPG 7215 / KCTC 17166 / NRRL Y-17582) (Yeast)"
},
"name": "Non-structural maintenance of chromosomes element 4",
"description": [
"Component of the SMC5-SMC6 complex, that promotes sister chromatid alignment after DNA damage and facilitates double-stranded DNA breaks (DSBs) repair via homologous recombination between sister chromatids"
],
"length": 382,
"sequence": "MTDELPTVKKRRIATDSVGEEVVEGAFGKEFQILQGYRDFENEVIQDRAAVSRTGDISVAMQRLKEVNLLFRKAGDLDLNINSLYAQDSHAVMNVSELASISVRNLKLTDAGKVLKVDDIINSAKRYMLVDFFSELRGEAQSVPTDNDNEEQEQDEENAGDEGDEGVNAGVDSTSNHQFKQNKLRSAFLKQFEVYDDFNQFNWFRMGALFQHLSKSPTVVDHMLGPLAVQKKQRVASQRRPAENIGEKITADTVTKETLSVNQEETTPEQVKKCFKVLLEKNGYNQISLFKFIIDPNSYSRSIEHLFYTSFLIKEGRLVLEDDENGYPAIRPKEPLPTDPKEREIERQRRSDASQKHLIFQMDMPTWKVLIKKFKITDSFLA",
"proteome": "UP000006790",
"gene": "Ecym_5634",
"go_terms": [
{
"identifier": "GO:0006281",
"name": "DNA repair",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005634",
"name": "nucleus",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0030915",
"name": "Smc5-Smc6 complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1fd77b4221e74ab0cc1708518c228bf021da2dd4",
"counters": {
"domain_architectures": 2524,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 2524
}
}
}