General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "I4Y788",
        "id": "I4Y788_WALMC",
        "source_organism": {
            "taxId": "671144",
            "scientificName": "Wallemia mellicola (strain ATCC MYA-4683 / CBS 633.66)",
            "fullName": "Wallemia mellicola (strain ATCC MYA-4683 / CBS 633.66)"
        },
        "name": "thioredoxin-dependent peroxiredoxin",
        "description": [
            "Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively"
        ],
        "length": 195,
        "sequence": "MASLIGKQAPEISGTVVREGLFEEVSNKTYEGKWLLLFFYPMDFTFVCPTEILAFNKALPRFQELGVEVLGASTDSEFTHLAWSNVPRNEGGLGPDLKLPLLADKSHKVSKNYGVLLDDGVTLRGSFLIDPKGVLRQITVNDLPVGRSVEESIRLIKAFQFTDVHGEVCPADWNPETNNSTINPENKSEYFSKQQ",
        "proteome": "UP000005242",
        "gene": "WALSEDRAFT_30118",
        "go_terms": [
            {
                "identifier": "GO:0016209",
                "name": "antioxidant activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051920",
                "name": "peroxiredoxin activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "9db26b9b236ea914ef8a2d52a7760b3ae17fb31b",
        "counters": {
            "domain_architectures": 37286,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "ssf": 1,
                "pfam": 2,
                "cdd": 1,
                "pirsf": 1,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 37286
        }
    }
}