GET /api/protein/UniProt/I4Y5W1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "I4Y5W1",
        "id": "I4Y5W1_WALMC",
        "source_organism": {
            "taxId": "671144",
            "scientificName": "Wallemia mellicola (strain ATCC MYA-4683 / CBS 633.66)",
            "fullName": "Wallemia mellicola (strain ATCC MYA-4683 / CBS 633.66)"
        },
        "name": "FACT complex subunit POB3",
        "description": [
            "Component of the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. During transcription elongation the FACT complex acts as a histone chaperone that both destabilizes and restores nucleosomal structure. It facilitates the passage of RNA polymerase II and transcription by promoting the dissociation of one histone H2A-H2B dimer from the nucleosome, then subsequently promotes the reestablishment of the nucleosome following the passage of RNA polymerase II"
        ],
        "length": 564,
        "sequence": "MSVDFDKIFHELNPTPGILRLQQGGLGWKSADNLVTIAADDISYMQWMRVARNFQLKIGLKSEKERQTFDGLVRDDYERLSKTVKEFYGVTLETREISFRGWNWGRTEYRGSDLSFQVSGRTMFEIPVQKIANSNIASKTEVSLEFIDPTASAQGEPTSGPSSSRRADELVEMRFYIPNSSKARGFIGDNDDDDSKSQKSDQEEQSVAQLFHDQIKDKAEIGKVSGDGLVVFNDILVVTPRGRYEIDMYPTFIRLRGKTYDYKILYSSIKRLFVLPKTDDMHVLLVVGLDPPIRQGQTRYPYITMQFPNNEELDATINMEESEIQEKYGDRLQKHYDAPAYQVVAQVFRGLSGKDITTPKTFKSFSNQPAIKCNVKANQGDLYVMEKSLFFVTKQPIYIPFSDIQSAQFARVGGAISSSRTFDLRIVQKSGTENVFSGINREEHEPLEEFFTNKKIKTKNNLNEDLIGAPIQIQEESDSEMDEDDKRASKANVGQRDEDDESEEDEDFEASSSDEGSPSEASSDEEEDDDGDKKMSKKSKDSEGPPKKKARKEKSDEVVQMDSD",
        "proteome": "UP000005242",
        "gene": "WALSEDRAFT_58804",
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005634",
                "name": "nucleus",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e1bd84826bfb43d2b2d9ee132e5ab9b176f3fb15",
        "counters": {
            "domain_architectures": 2053,
            "entries": 21,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "pfam": 4,
                "cdd": 2,
                "ssf": 1,
                "smart": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 8
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2053
        }
    }
}