GET /api/protein/UniProt/I4Y5W1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "I4Y5W1",
"id": "I4Y5W1_WALMC",
"source_organism": {
"taxId": "671144",
"scientificName": "Wallemia mellicola (strain ATCC MYA-4683 / CBS 633.66)",
"fullName": "Wallemia mellicola (strain ATCC MYA-4683 / CBS 633.66)"
},
"name": "FACT complex subunit POB3",
"description": [
"Component of the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. During transcription elongation the FACT complex acts as a histone chaperone that both destabilizes and restores nucleosomal structure. It facilitates the passage of RNA polymerase II and transcription by promoting the dissociation of one histone H2A-H2B dimer from the nucleosome, then subsequently promotes the reestablishment of the nucleosome following the passage of RNA polymerase II"
],
"length": 564,
"sequence": "MSVDFDKIFHELNPTPGILRLQQGGLGWKSADNLVTIAADDISYMQWMRVARNFQLKIGLKSEKERQTFDGLVRDDYERLSKTVKEFYGVTLETREISFRGWNWGRTEYRGSDLSFQVSGRTMFEIPVQKIANSNIASKTEVSLEFIDPTASAQGEPTSGPSSSRRADELVEMRFYIPNSSKARGFIGDNDDDDSKSQKSDQEEQSVAQLFHDQIKDKAEIGKVSGDGLVVFNDILVVTPRGRYEIDMYPTFIRLRGKTYDYKILYSSIKRLFVLPKTDDMHVLLVVGLDPPIRQGQTRYPYITMQFPNNEELDATINMEESEIQEKYGDRLQKHYDAPAYQVVAQVFRGLSGKDITTPKTFKSFSNQPAIKCNVKANQGDLYVMEKSLFFVTKQPIYIPFSDIQSAQFARVGGAISSSRTFDLRIVQKSGTENVFSGINREEHEPLEEFFTNKKIKTKNNLNEDLIGAPIQIQEESDSEMDEDDKRASKANVGQRDEDDESEEDEDFEASSSDEGSPSEASSDEEEDDDGDKKMSKKSKDSEGPPKKKARKEKSDEVVQMDSD",
"proteome": "UP000005242",
"gene": "WALSEDRAFT_58804",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005634",
"name": "nucleus",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e1bd84826bfb43d2b2d9ee132e5ab9b176f3fb15",
"counters": {
"domain_architectures": 2053,
"entries": 21,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 3,
"pfam": 4,
"cdd": 2,
"ssf": 1,
"smart": 1,
"panther": 1,
"prints": 1,
"interpro": 8
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 2053
}
}
}