General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "I4E2M8",
        "id": "I4E2M8_NEIME",
        "source_organism": {
            "taxId": "996307",
            "scientificName": "Neisseria meningitidis alpha522",
            "fullName": "Neisseria meningitidis alpha522"
        },
        "name": "Small-conductance mechanosensitive channel",
        "description": [
            "Mechanosensitive channel that participates in the regulation of osmotic pressure changes within the cell, opening in response to stretch forces in the membrane lipid bilayer, without the need for other proteins. Contributes to normal resistance to hypoosmotic shock. Forms an ion channel of 1.0 nanosiemens conductance with a slight preference for anions"
        ],
        "length": 282,
        "sequence": "MDFKQFDFLHLISVSGWEHLAEKAWAFGLNLAAALLIFLVGKWAAKRIVAVMRAAMTRAQVDATLISFLCNVANIGLLILVIIAALGRLGVSTTSVTALIGGAGLAVALSLKDQLSNFAAGALIILFRPFKVGDFIRVGGFEGYVREIKMVQTSLRTTDNEEVVLPNSVVMGNSIVNRSTLPLCRAQVIVGVDYNCDLKVAKEAVLKAAVEHPLSVQNEERQAAAYITALGDNAIEITLWAWANEADRWTLQCDLNEQVVENLRKVNINIPFPQRDIHIINS",
        "proteome": null,
        "gene": "NMALPHA522_0046",
        "go_terms": [
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0055085",
                "name": "transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008381",
                "name": "mechanosensitive monoatomic ion channel activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "75f16d9f161d7789c23211038f9f34567c215b25",
        "counters": {
            "domain_architectures": 2501,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "ssf": 3,
                "pfam": 3,
                "panther": 1,
                "interpro": 8
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 2501
        }
    }
}