GET /api/protein/UniProt/I3Y6X2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "I3Y6X2",
        "id": "I3Y6X2_THIV6",
        "source_organism": {
            "taxId": "765911",
            "scientificName": "Thiocystis violascens (strain ATCC 17096 / DSM 198 / 6111)",
            "fullName": "Thiocystis violascens (strain ATCC 17096 / DSM 198 / 6111)"
        },
        "name": "Type III pantothenate kinase",
        "description": [
            "Catalyzes the phosphorylation of pantothenate (Pan), the first step in CoA biosynthesis"
        ],
        "length": 256,
        "sequence": "MLLLDIGNTNLRWTTQAAGRLGEVRILRHGGGMTLDLLAAWEALGAPSRILVSNVGGAAVAESLRRVTRAYWGLDPEFVSTRADFGGVRIAYAEPARFGVDRWLTLIAAHAPALDDAGTAPRQPTLILDAGTAATFDLLLADGRHLGGLILPGIEMMRNSLLAGTQIPRIESEPVGDPWAQDTGTAVAAGSVQAIAALARRLLDRLTEQAGATPRLLLTGGDAQRLRSALDRPFQEIPDLVLRGLLQVAERIPLSG",
        "proteome": "UP000006062",
        "gene": "coaX",
        "go_terms": [
            {
                "identifier": "GO:0004594",
                "name": "pantothenate kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "34a0011a5f1d2a889fee47cd426d5028e15e7d37",
        "counters": {
            "domain_architectures": 17983,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "pfam": 1,
                "ncbifam": 1,
                "hamap": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 17983
        }
    }
}