GET /api/protein/UniProt/I3WHG8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "I3WHG8",
        "id": "I3WHG8_BIFBI",
        "source_organism": {
            "taxId": "484020",
            "scientificName": "Bifidobacterium bifidum BGN4",
            "fullName": "Bifidobacterium bifidum BGN4"
        },
        "name": "Bifunctional protein FolD",
        "description": [
            "Catalyzes the oxidation of 5,10-methylenetetrahydrofolate to 5,10-methenyltetrahydrofolate and then the hydrolysis of 5,10-methenyltetrahydrofolate to 10-formyltetrahydrofolate"
        ],
        "length": 291,
        "sequence": "MTIKLDGKRVAAEVKANLAERVSTLKEHGIVPGLGTLLVGEDPGSMKYVAGKHADCAEVGIRSIRRDLPADASFDDIAAAVRDLNEDPACTGYIVQLPLPRGVDENAIIGLIDPSKDADGMHPYNLGELVLHVQGDITTPLPCTPRGVIELLDAYDIDLNGKEVCVLGRGITIGRTIGLLLTRKAVNATVTLCHTGTRDIADHMRRADVIVAAMGSAGFVKPENVKDGAVLMDVGVSRVFDEQTGRFRIRGDVDKACYDKVSAYSPNPGGVGPMTRAMLLANVVEMAERKM",
        "proteome": null,
        "gene": "folD",
        "go_terms": [
            {
                "identifier": "GO:0004488",
                "name": "methylenetetrahydrofolate dehydrogenase (NADP+) activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "23f8e7ee0e8caf68810771f795143dc480826ffa",
        "counters": {
            "domain_architectures": 36777,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "pfam": 2,
                "cathgene3d": 2,
                "cdd": 1,
                "ncbifam": 1,
                "hamap": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 36777
        }
    }
}