General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "I3VRB7",
        "id": "I3VRB7_THESW",
        "source_organism": {
            "taxId": "1094508",
            "scientificName": "Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485)",
            "fullName": "Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485)"
        },
        "name": "Aspartate 1-decarboxylase",
        "description": [
            "Catalyzes the pyruvoyl-dependent decarboxylation of aspartate to produce beta-alanine"
        ],
        "length": 117,
        "sequence": "MQRFMMKSKIHRATVTDANLNYMGSITIDKRLMDLADILPGEKVQIVNNNNGARFETYVIEGEEDSGIVCLNGAAARLCLPGDIIIIISYALMDDEEAKTYKPKVVFVDEKNRPLKG",
        "proteome": "UP000006178",
        "gene": "panD",
        "go_terms": [
            {
                "identifier": "GO:0004068",
                "name": "aspartate 1-decarboxylase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006523",
                "name": "alanine biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0b7b5ce52bb1bd746a6906a9248f88bc2d6f781c",
        "counters": {
            "domain_architectures": 14721,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "ncbifam": 1,
                "panther": 1,
                "pirsf": 1,
                "hamap": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 14721
        }
    }
}