General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "I3PX35",
        "id": "I3PX35_9CHLO",
        "source_organism": {
            "taxId": "663923",
            "scientificName": "Elliptochloris reniformis",
            "fullName": "Elliptochloris reniformis"
        },
        "name": "Ribulose bisphosphate carboxylase large subunit C-terminal domain-containing protein",
        "description": [
            "RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate in the photorespiration process. Both reactions occur simultaneously and in competition at the same active site"
        ],
        "length": 73,
        "sequence": "GGGTLGHPWGNAPGAAANRVALEACVQARNEGRDLAREGGDVIRAACKWSPELAAACEVWKEIKFEFDTIDKL",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0000287",
                "name": "magnesium ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016984",
                "name": "ribulose-bisphosphate carboxylase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "fa410ff332f1b1bf57c66a9da98ce0a2e9fabf3c",
        "counters": {
            "domain_architectures": 18505,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 18505
        }
    }
}