GET /api/protein/UniProt/I3PKZ6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "I3PKZ6",
        "id": "I3PKZ6_9TELE",
        "source_organism": {
            "taxId": "1138469",
            "scientificName": "Leptostichaeus pumilus",
            "fullName": "Leptostichaeus pumilus (neck banded blenny)"
        },
        "name": "Cytochrome b",
        "description": [
            "Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex) that is part of the mitochondrial respiratory chain. The b-c1 complex mediates electron transfer from ubiquinol to cytochrome c. Contributes to the generation of a proton gradient across the mitochondrial membrane that is then used for ATP synthesis"
        ],
        "length": 194,
        "sequence": "TAFSSVGHICRDVNYGWLIRNLHANGASFFFICLYMHIGRGLYYGSYLYKETWNVGVVLMLLVMMTAFVGYVLPWGQMSFWGATVITNLLSAVPYIGGSLVQWIWGGFSVDNATLTRFFAFHFLFPFVIAGATMVHFLFLHQTGSNNPLGLNSDADKIPFHPYFSYKDLLGFAALLVGLTALALFSPNLLGDPD",
        "proteome": null,
        "gene": "cytb",
        "go_terms": [
            {
                "identifier": "GO:0009055",
                "name": "electron transfer activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0022904",
                "name": "respiratory electron transport chain",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "be34220e9275984b10f29960f25876d49b60ca7d",
        "counters": {
            "domain_architectures": 86317,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "cdd": 1,
                "profile": 2,
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 86317
        }
    }
}