GET /api/protein/UniProt/I3N095/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "I3N095",
"id": "I3N095_ICTTR",
"source_organism": {
"taxId": "43179",
"scientificName": "Ictidomys tridecemlineatus",
"fullName": "Ictidomys tridecemlineatus (Thirteen-lined ground squirrel)"
},
"name": "Mitochondrial fission 1 protein",
"description": [
"Involved in the fragmentation of the mitochondrial network and its perinuclear clustering. Plays a minor role in the recruitment and association of the fission mediator dynamin-related protein 1 (DNM1L) to the mitochondrial surface and mitochondrial fission. May not be essential for the assembly of functional fission complexes and the subsequent membrane scission event. Also mediates peroxisomal fission. May act when the products of fission are directed toward mitochondrial homeostasis, mitophagy, or apoptosis. Can induce cytochrome c release from the mitochondrion to the cytosol, ultimately leading to apoptosis"
],
"length": 152,
"sequence": "MEAVLNELVSVDDLMKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNEDIRKGIALLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALRYVRGLLQTEPQNSQARELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS",
"proteome": "UP000005215",
"gene": "FIS1",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0000266",
"name": "mitochondrial fission",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "4b7e25eb1883ed2600b5feaf83f54d8a387ed951",
"counters": {
"domain_architectures": 3822,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"cdd": 1,
"pfam": 2,
"pirsf": 1,
"panther": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3822
}
}
}