GET /api/protein/UniProt/I3MQY1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "I3MQY1",
"id": "I3MQY1_ICTTR",
"source_organism": {
"taxId": "43179",
"scientificName": "Ictidomys tridecemlineatus",
"fullName": "Ictidomys tridecemlineatus (Thirteen-lined ground squirrel)"
},
"name": "Neuroblastoma suppressor of tumorigenicity 1",
"description": [
"Possible candidate as a tumor suppressor gene of neuroblastoma. May play an important role in preventing cells from entering the final stage (G1/S) of the transformation process"
],
"length": 180,
"sequence": "MLQVLVGAVFPAMLLAAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEVVPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGEDAPGAQPGSHPHPHPHPHPGGQTPEPEEPPGAPHAEEEGAED",
"proteome": "UP000005215",
"gene": "NBL1",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a1706f3a392a3e87273a6981f3ecd6b51d020763",
"counters": {
"domain_architectures": 5563,
"entries": 7,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"pfam": 1,
"smart": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 5563
}
}
}