General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "I3MQY1",
        "id": "I3MQY1_ICTTR",
        "source_organism": {
            "taxId": "43179",
            "scientificName": "Ictidomys tridecemlineatus",
            "fullName": "Ictidomys tridecemlineatus (Thirteen-lined ground squirrel)"
        },
        "name": "Neuroblastoma suppressor of tumorigenicity 1",
        "description": [
            "Possible candidate as a tumor suppressor gene of neuroblastoma. May play an important role in preventing cells from entering the final stage (G1/S) of the transformation process"
        ],
        "length": 180,
        "sequence": "MLQVLVGAVFPAMLLAAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEVVPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGEDAPGAQPGSHPHPHPHPHPGGQTPEPEEPPGAPHAEEEGAED",
        "proteome": "UP000005215",
        "gene": "NBL1",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a1706f3a392a3e87273a6981f3ecd6b51d020763",
        "counters": {
            "domain_architectures": 5563,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "smart": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5563
        }
    }
}