GET /api/protein/UniProt/I3MQV0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "I3MQV0",
"id": "I3MQV0_ICTTR",
"source_organism": {
"taxId": "43179",
"scientificName": "Ictidomys tridecemlineatus",
"fullName": "Ictidomys tridecemlineatus (Thirteen-lined ground squirrel)"
},
"name": "F-box and leucine-rich protein 22",
"description": [
"Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. Promotes ubiquitination of sarcomeric proteins alpha-actinin-2 (ACTN2) and filamin-C (FLNC)"
],
"length": 229,
"sequence": "MPFTMHITQLNRECLLHLFSFLDKDSRKSLARTCSQLHDVFEDPALWPLLHFRSLTELKKDNFLLGPALRSLSICWHSSQVQVCSIEDWLKSTFQRSICSRHESLVSDFLLQVCDRCPNLASVTLSGCGHVTDDCLARLLRSCPRLRALRLENCARVTNRTLAAVAAHGGALQTLHVDFCRNVSAAGLRRLRAACPRLVLRAEHSAAMIPDQVPRPPASGTALRKLLPS",
"proteome": "UP000005215",
"gene": "FBXL22",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "3ebb2b79836e06012b0d65e4592940f278ad23bf",
"counters": {
"domain_architectures": 93656,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 2,
"cdd": 1,
"pfam": 1,
"smart": 1,
"panther": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 93656
}
}
}