General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "I3MN17",
        "id": "I3MN17_ICTTR",
        "source_organism": {
            "taxId": "43179",
            "scientificName": "Ictidomys tridecemlineatus",
            "fullName": "Ictidomys tridecemlineatus (Thirteen-lined ground squirrel)"
        },
        "name": "Dynein regulatory complex protein 12",
        "description": [
            "Component of the nexin-dynein regulatory complex (N-DRC), a key regulator of ciliary/flagellar motility which maintains the alignment and integrity of the distal axoneme and regulates microtubule sliding in motile axonemes"
        ],
        "length": 217,
        "sequence": "MSRTIKSPLPQDSQDMPPKTKEKGRKSGTQKKKKNLSVDVEAEAKHRLMVLEKELLLDHLALRRDESRRAKASEELLKQKLQGLEAELKEARSEEKAIYAEMSRQHQALKEKLETRSNQLEEEVRSLREQLEMCQKEAKAEREEAEQALRERDQTLTQLRAQVVDMEAKYQEILHGSLDQLLAKLRAVKPHWDGAVLRLHAKHKEQLRQFGLNPLDL",
        "proteome": "UP000005215",
        "gene": "DRC12",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": null,
        "counters": {
            "domain_architectures": 0,
            "entries": 2,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1
        }
    }
}