HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "I3M5L7",
"id": "I3M5L7_ICTTR",
"source_organism": {
"taxId": "43179",
"scientificName": "Ictidomys tridecemlineatus",
"fullName": "Ictidomys tridecemlineatus (Thirteen-lined ground squirrel)"
},
"name": "LIM homeobox transcription factor 1-alpha",
"description": [
"Acts as a transcriptional activator by binding to an A/T-rich sequence, the FLAT element, in the insulin gene promoter. Required for development of the roof plate and, in turn, for specification of dorsal cell fates in the CNS and developing vertebrae"
],
"length": 382,
"sequence": "MLDGLKMEENFQSAIETSASFSSLLGRAVSPKSVCEGCQRVISDRFLLRLNDSFWHEQCVRCASCKEPLETTCFYRDKKLYCKYDYEKLFAVKCGGCFEAITPNEFVMRAQKSVYHLSCFCCCVCERQLQKGDEFVLKEGQLLCKGDYEKERELLSLVSPAASDSGKSDEEESLCKSAPGAGKGASEDGKDHKRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKLARRQQQQQQDQQNTQRLSSAQTNGGGSAGMEGIMNPYTALPTPQQLLAIEQSVYSSDPFRQGLTPPQMPGDHMHPYGAEPLFHDLDSDDTSLSNLGDCFLATSESGPLQSRVGNPIDHLYSMQNSYFTS",
"proteome": "UP000005215",
"gene": "LMX1A",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0000981",
"name": "DNA-binding transcription factor activity, RNA polymerase II-specific",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "9df4db78da89de75c996e6971cfd5463e5e014f5",
"counters": {
"domain_architectures": 13971,
"entries": 22,
"isoforms": 0,
"proteomes": 1,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"profile": 2,
"smart": 2,
"cdd": 3,
"cathgene3d": 2,
"pfam": 2,
"panther": 1,
"prosite": 2,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 13971
}
}
}