GET /api/protein/UniProt/I3M540/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "I3M540",
        "id": "I3M540_ICTTR",
        "source_organism": {
            "taxId": "43179",
            "scientificName": "Ictidomys tridecemlineatus",
            "fullName": "Ictidomys tridecemlineatus (Thirteen-lined ground squirrel)"
        },
        "name": "Homeobox domain-containing protein",
        "description": [
            "Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis"
        ],
        "length": 270,
        "sequence": "MCERSLYRAGYVGSLLNLQSPDSFYFSNLRPNGGQLAALPPISYPRGALPWAATPASCTPAQPASATAFGGFSQPYLAGSGPLGLQPPGAKDGPEEQVKFYAPDAASGPEERGRTRQPFVPESSLAPAAAALKAAKYDYAGMSRVAPGSATLLQGAPCAANFKEDTKGPLNLNMTMQAAGVASCLRPSLPDGLPWGSAPGRARKKRKPYTKQQIAELENEFLVNEFINRQKRKELSNRLNLSDQQVKIWFQNRRMKKKRVVLREQALALY",
        "proteome": "UP000005215",
        "gene": "HOXD12",
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0000981",
                "name": "DNA-binding transcription factor activity, RNA polymerase II-specific",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006355",
                "name": "regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1cca9db9652b5e6e0313f2eed7be72cec278d12f",
        "counters": {
            "domain_architectures": 145457,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "smart": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 145457
        }
    }
}