HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "I3M540",
"id": "I3M540_ICTTR",
"source_organism": {
"taxId": "43179",
"scientificName": "Ictidomys tridecemlineatus",
"fullName": "Ictidomys tridecemlineatus (Thirteen-lined ground squirrel)"
},
"name": "Homeobox domain-containing protein",
"description": [
"Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis"
],
"length": 270,
"sequence": "MCERSLYRAGYVGSLLNLQSPDSFYFSNLRPNGGQLAALPPISYPRGALPWAATPASCTPAQPASATAFGGFSQPYLAGSGPLGLQPPGAKDGPEEQVKFYAPDAASGPEERGRTRQPFVPESSLAPAAAALKAAKYDYAGMSRVAPGSATLLQGAPCAANFKEDTKGPLNLNMTMQAAGVASCLRPSLPDGLPWGSAPGRARKKRKPYTKQQIAELENEFLVNEFINRQKRKELSNRLNLSDQQVKIWFQNRRMKKKRVVLREQALALY",
"proteome": "UP000005215",
"gene": "HOXD12",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0000981",
"name": "DNA-binding transcription factor activity, RNA polymerase II-specific",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1cca9db9652b5e6e0313f2eed7be72cec278d12f",
"counters": {
"domain_architectures": 145457,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"profile": 1,
"smart": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"prosite": 1,
"prints": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 145457
}
}
}