General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "I3LW98",
        "id": "I3LW98_ICTTR",
        "source_organism": {
            "taxId": "43179",
            "scientificName": "Ictidomys tridecemlineatus",
            "fullName": "Ictidomys tridecemlineatus (Thirteen-lined ground squirrel)"
        },
        "name": "L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase",
        "description": [
            "Catalyzes the post-translational modification of target proteins by phosphopantetheine. Can transfer the 4'-phosphopantetheine moiety from coenzyme A, regardless of whether the CoA is presented in the free thiol form or as an acetyl thioester, to a serine residue of a broad range of acceptors including the acyl carrier domain of FASN"
        ],
        "length": 309,
        "sequence": "MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKLVAEKLNIPWNHIRLQRTAKGKPVLAKDSLNPYPNFNFNISHQGDYAVLAAEPELQVGIDIMKTSFPGRGSIPEFFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIKAIGVGLGFELQRLEFDISPLNLDIGEVYKETRLFLDGEEEKEWAFEESKIDEHHFVAVALRKPNGSRHEDVSSQDDSIPTQRQFTILTFNDLISSAVPMTPEDPSFWDCFCFTEEIPIRNGTKS",
        "proteome": "UP000005215",
        "gene": "AASDHPPT",
        "go_terms": [
            {
                "identifier": "GO:0000287",
                "name": "magnesium ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008897",
                "name": "holo-[acyl-carrier-protein] synthase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0614c47acd1855d731925b5aa8d51ca5e72292bb",
        "counters": {
            "domain_architectures": 8634,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 2,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 8634
        }
    }
}