GET /api/protein/UniProt/I3KBF7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "I3KBF7",
"id": "I3KBF7_ORENI",
"source_organism": {
"taxId": "8128",
"scientificName": "Oreochromis niloticus",
"fullName": "Oreochromis niloticus (Nile tilapia)"
},
"name": "F-actin-capping protein subunit alpha",
"description": [
"F-actin-capping proteins bind in a Ca(2+)-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments. May play a role in the formation of epithelial cell junctions. Forms, with CAPZB, the barbed end of the fast growing ends of actin filaments in the dynactin complex and stabilizes dynactin structure. The dynactin multiprotein complex activates the molecular motor dynein for ultra-processive transport along microtubules"
],
"length": 282,
"sequence": "TSDFTMSCLVRIAANFVMHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQFTRAKIDGYEEPVLITEHGDLGNGRFFDPHNKISFKFDHLRKEASDPQPHQGEAALSSWRDACDSAIRAYVKEHYPSGVSTVYGKTIDGQKTIIACIEGHQYEPKNFWNGRCRSEWKFSVSQPTAQVAGVLKIQVHYYEDGNVQLVSHKDVQKSLTVSNESQTAKELVKIIEDAENEYQVAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA",
"proteome": "UP000005207",
"gene": "capza1a",
"go_terms": [
{
"identifier": "GO:0051016",
"name": "barbed-end actin filament capping",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0008290",
"name": "F-actin capping protein complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ff85381e43d61365e37cf09fabf43be10b65d3f9",
"counters": {
"domain_architectures": 6385,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 1,
"panther": 1,
"pfam": 1,
"prints": 1,
"prosite": 2,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 6385
}
}
}