HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "I3JWU5",
"id": "I3JWU5_ORENI",
"source_organism": {
"taxId": "8128",
"scientificName": "Oreochromis niloticus",
"fullName": "Oreochromis niloticus (Nile tilapia)"
},
"name": "Serine/threonine-protein kinase 25",
"description": [
"Oxidant stress-activated serine/threonine kinase that may play a role in the response to environmental stress. Targets to the Golgi apparatus where it appears to regulate protein transport events, cell adhesion, and polarity complexes important for cell migration. Part of the striatin-interacting phosphatase and kinase (STRIPAK) complexes. STRIPAK complexes have critical roles in protein (de)phosphorylation and are regulators of multiple signaling pathways including Hippo, MAPK, nuclear receptor and cytoskeleton remodeling. Different types of STRIPAK complexes are involved in a variety of biological processes such as cell growth, differentiation, apoptosis, metabolism and immune regulation"
],
"length": 382,
"sequence": "MAHLRDMQNQNTRLDPEEYFTKQERIGKGSFGEVYKGINNRTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKGTKLWIIMEYLGGGSALDLLRPGPLEETYIATILREILKGLEYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNTPPTLEGPYSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKKTAYLTELIDRYRRWKSEGHGEESKVRQTERRQPKSQCLSALVTPTFRELKEKRRASGGGVGAIEELENAFNLAEESCPGISDRLVTHVMERVCRFSLNGNTTPSSR",
"proteome": "UP000005207",
"gene": "STK25",
"go_terms": [
{
"identifier": "GO:0004672",
"name": "protein kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006468",
"name": "protein phosphorylation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "cf0b33001e52ae8ed529043c42c55d0468b74560",
"counters": {
"domain_architectures": 3951,
"entries": 17,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 3,
"ssf": 1,
"smart": 1,
"profile": 1,
"pfam": 2,
"cdd": 1,
"panther": 1,
"prosite": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3951
}
}
}