GET /api/protein/UniProt/I3JI52/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "I3JI52",
        "id": "I3JI52_ORENI",
        "source_organism": {
            "taxId": "8128",
            "scientificName": "Oreochromis niloticus",
            "fullName": "Oreochromis niloticus (Nile tilapia)"
        },
        "name": "BTB domain-containing protein",
        "description": [
            "Adapter protein for the cul3 E3 ubiquitin-protein ligase complex. Promotes the export of zbtb16/plzf from the nucleus to the cytoplasm and targets zbtb16/plzf for ubiquitination and degradation. Up-regulates neurog1 expression and antagonizes zbtb16/plzf, to promote neurogenesis"
        ],
        "length": 484,
        "sequence": "SAKRTKKQHTVFYEEQIIKSTPVTMAAELFPTKKLVPAASVQQYQQQNITNNNTSVTGCNWQGLYPTIRERNSVMFNNEMMADVHFVVGPPGGTQRVPGHKYVLAVGSSVFHAMFYGELAEDQDEIRIPDVEPPSFLAMLKYIYCDEIDLCADTVLATLYAAKKYIVPHLARACVNFLETSLSAKNACVLLSQSCLFEEPDLTQRCWEVIDAQAELALRSEGFCDIDIQTLESILRRETLNAKEMVVFEAALNWAEAECQRQDLPPTIENKRLVLGKAIYLIRIPTMALEDFANGAAQSGVLTLNETNDIFLWYTAAKKPDLLFCTKPRKGLSPQRCHRFQSCAYRSNQWRYRGRCDSIQFAVDKRVFIAGFGLYGSSCGSAEYSAKIELKRQGVPMAQRIIKYFSDGSSSTFPVWFEYPVQIEPDTFYTASVVLDGNELSYFGQEGMTEVQCGKVTFQFQCSSDSTNGTGVQGGQIPELIFYA",
        "proteome": "UP000005207",
        "gene": "LOC100710091",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b0835ee1c753a5ab749d9526dfc1b94194892592",
        "counters": {
            "domain_architectures": 5413,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 3,
                "cdd": 2,
                "pfam": 3,
                "profile": 1,
                "smart": 2,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5413
        }
    }
}