GET /api/protein/UniProt/I3JI52/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "I3JI52",
"id": "I3JI52_ORENI",
"source_organism": {
"taxId": "8128",
"scientificName": "Oreochromis niloticus",
"fullName": "Oreochromis niloticus (Nile tilapia)"
},
"name": "BTB domain-containing protein",
"description": [
"Adapter protein for the cul3 E3 ubiquitin-protein ligase complex. Promotes the export of zbtb16/plzf from the nucleus to the cytoplasm and targets zbtb16/plzf for ubiquitination and degradation. Up-regulates neurog1 expression and antagonizes zbtb16/plzf, to promote neurogenesis"
],
"length": 484,
"sequence": "SAKRTKKQHTVFYEEQIIKSTPVTMAAELFPTKKLVPAASVQQYQQQNITNNNTSVTGCNWQGLYPTIRERNSVMFNNEMMADVHFVVGPPGGTQRVPGHKYVLAVGSSVFHAMFYGELAEDQDEIRIPDVEPPSFLAMLKYIYCDEIDLCADTVLATLYAAKKYIVPHLARACVNFLETSLSAKNACVLLSQSCLFEEPDLTQRCWEVIDAQAELALRSEGFCDIDIQTLESILRRETLNAKEMVVFEAALNWAEAECQRQDLPPTIENKRLVLGKAIYLIRIPTMALEDFANGAAQSGVLTLNETNDIFLWYTAAKKPDLLFCTKPRKGLSPQRCHRFQSCAYRSNQWRYRGRCDSIQFAVDKRVFIAGFGLYGSSCGSAEYSAKIELKRQGVPMAQRIIKYFSDGSSSTFPVWFEYPVQIEPDTFYTASVVLDGNELSYFGQEGMTEVQCGKVTFQFQCSSDSTNGTGVQGGQIPELIFYA",
"proteome": "UP000005207",
"gene": "LOC100710091",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b0835ee1c753a5ab749d9526dfc1b94194892592",
"counters": {
"domain_architectures": 5413,
"entries": 18,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 3,
"cdd": 2,
"pfam": 3,
"profile": 1,
"smart": 2,
"panther": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 5413
}
}
}