General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "I3J8Z6",
        "id": "I3J8Z6_ORENI",
        "source_organism": {
            "taxId": "8128",
            "scientificName": "Oreochromis niloticus",
            "fullName": "Oreochromis niloticus (Nile tilapia)"
        },
        "name": "SPARC",
        "description": [
            "Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity"
        ],
        "length": 282,
        "sequence": "MRVWIVFLLCLAGHAMAAPETEVGANPVQVEIGEFDEAIDIVEDVVTENACLNYHCKKGKVCEVDESNTPMCVCQDPSTCPPVEGDFEHVCGTDNKTYESSCHFFATKCTLEGTKKGHKLHLDYIGSCKLIEPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIYENEKRLQAGDHSLDLLAHDFEKNYNMYIFPVHWQFGQLDQHPVDGYLTHTELAPLRAPLIPMEHCTTRFFEQCDADADKYIALEEWAACFGLKDQDVDKDLII",
        "proteome": "UP000005207",
        "gene": "SPARC",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005509",
                "name": "calcium ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005615",
                "name": "extracellular space",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "119299a3f445f62dd22b96ae1316a9072559340d",
        "counters": {
            "domain_architectures": 818,
            "entries": 26,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 5,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 3,
                "smart": 2,
                "pfam": 3,
                "cdd": 2,
                "profile": 1,
                "panther": 1,
                "prosite": 3,
                "interpro": 9
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 818
        }
    }
}