HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "I2H7P5",
"id": "I2H7P5_HENB6",
"source_organism": {
"taxId": "1071380",
"scientificName": "Henningerozyma blattae (strain ATCC 34711 / CBS 6284 / DSM 70876 / NBRC 10599 / NRRL Y-10934 / UCD 77-7)",
"fullName": "Henningerozyma blattae (strain ATCC 34711 / CBS 6284 / DSM 70876 / NBRC 10599 / NRRL Y-10934 / UCD 77-7) (Yeast)"
},
"name": "Transcription initiation factor TFIID subunit 10",
"description": [
"Functions as a component of both the DNA-binding general transcription initiation factor complex TFIID and the transcription coactivator SAGA complex. Binding of TFIID to a promoter (with or without TATA element) is the initial step in pre-initiation complex (PIC) formation. TFIID plays a key role in the regulation of gene expression by RNA polymerase II through different activities such as transcription activator interaction, core promoter recognition and selectivity, TFIIA and TFIIB interaction, chromatin modification (histone acetylation by TAF1), facilitation of DNA opening and initiation of transcription. SAGA acts as a general cofactor required for essentially all RNA polymerase II transcription. At the promoters, SAGA is required for transcription pre-initiation complex (PIC) recruitment. It influences RNA polymerase II transcriptional activity through different activities such as TBP interaction (via core/TAF module) and promoter selectivity, interaction with transcription activators (via Tra1/SPT module), and chromatin modification through histone acetylation (via HAT module) and deubiquitination (via DUB module). SAGA preferentially acetylates histones H3 (to form H3K9ac, H3K14ac, H3K18ac and H3K23ac) and H2B and deubiquitinates histone H2B. SAGA interacts with DNA via upstream activating sequences (UASs)"
],
"length": 209,
"sequence": "MSEKEFNEFGPVDSMNVDEEIDDEFNDNDDGGAVDNAALFQRAEEQEKLDQQETKMLDDGSGKLFELPEFTRKDKTLSELLDMMEDNAPIIPDPVIDYYMAKNGFQCGDVRVKRLLALATQKFISDIACDAYEYSRIRSSVAVYNANNGQSRARQLMMGQQNPGQQQISQQQAQQNEKTTASKVVLTVNDLSSAVAEYGLNISRPDFYR",
"proteome": "UP000002866",
"gene": "TBLA0H01090",
"go_terms": [
{
"identifier": "GO:0006352",
"name": "DNA-templated transcription initiation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005634",
"name": "nucleus",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "dad7816db51b05670cec5ac36b3e771f203f73b0",
"counters": {
"domain_architectures": 4141,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"pirsf": 1,
"panther": 1,
"pfam": 1,
"prints": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4141
}
}
}
