HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "I2H784",
"id": "I2H784_HENB6",
"source_organism": {
"taxId": "1071380",
"scientificName": "Henningerozyma blattae (strain ATCC 34711 / CBS 6284 / DSM 70876 / NBRC 10599 / NRRL Y-10934 / UCD 77-7)",
"fullName": "Henningerozyma blattae (strain ATCC 34711 / CBS 6284 / DSM 70876 / NBRC 10599 / NRRL Y-10934 / UCD 77-7) (Yeast)"
},
"name": "Aminomethyltransferase",
"description": [
"The glycine cleavage system catalyzes the degradation of glycine"
],
"length": 397,
"sequence": "MLKSTVTKRLNSSVTKASLKKTALHDLHVELGGTMVPYAGYSMPVLYKGQTHIESHNWTRTNAGLFDVSHMMQSRLTGKNAVSFLHKVTPTDFESLKADQGTLSVLLNNTGGIVDDTMITKEKENSFYVVTNAGCIKRDTEFLLGELKQIGEDVNWEVIKDKSLLALQGPKASQVFEKLLKEGQTTKDLYFGSRRSFQLYDGTTIDVARSGYTGEDGFEISVPNDKAENFARLLLDNSETKPIGLAARDSLRLEAGMCLYGHELDETITPVESGLNWLISKSRRAGEKGKFNGFDNIMDQLNNKNYTRTRIAFKYLGKGPAARPDAKIFTTDKSKQIGIVTSGSASPSLGNINIGQGYVDKAFRKSGTELLVEVRNKMFPIVLEKMPLFLLVTTEVK",
"proteome": "UP000002866",
"gene": "TBLA0G02990",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004047",
"name": "aminomethyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006546",
"name": "glycine catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005960",
"name": "glycine cleavage complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c1e551baf6f329da33c792fab5c6ee6271097f24",
"counters": {
"domain_architectures": 29375,
"entries": 18,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"cathgene3d": 4,
"pfam": 2,
"pirsf": 1,
"panther": 1,
"ncbifam": 2,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 29375
}
}
}