General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "I1YFS7",
        "id": "I1YFS7_METFJ",
        "source_organism": {
            "taxId": "754477",
            "scientificName": "Methylophaga frappieri (strain ATCC BAA-2434 / DSM 25690 / JAM7)",
            "fullName": "Methylophaga frappieri (strain ATCC BAA-2434 / DSM 25690 / JAM7)"
        },
        "name": "LPS-assembly lipoprotein LptE",
        "description": [
            "Together with LptD, is involved in the assembly of lipopolysaccharide (LPS) at the surface of the outer membrane. Required for the proper assembly of LptD. Binds LPS and may serve as the LPS recognition site at the outer membrane"
        ],
        "length": 167,
        "sequence": "MIKMNALRLLLVATLSLLMVACGFQLRGAAAMPDSIETLYIQGINIRDGLGLRLKRILNRNDVKVIDEYRDGAALMTFTENKLERRVMSVGVQTAKVAEYELILSVVYNLSDAQQNRLAEQERFEARRDYQFNPQQVLGRDAEEEILIEEMYEQVSQAIVRRLSALK",
        "proteome": "UP000009145",
        "gene": "lptE",
        "go_terms": [
            {
                "identifier": "GO:0043165",
                "name": "Gram-negative-bacterium-type cell outer membrane assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0019867",
                "name": "outer membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6078520e32cfccaafbf1dd6f542a8689798dbf70",
        "counters": {
            "domain_architectures": 12250,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "cathgene3d": 1,
                "hamap": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 12250
        }
    }
}